SNRPG, 1-76aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Small nuclear ribonucleoprotein polypeptide G, also known as SNRPG, belongs to the snRNP Sm proteins family. There are at least seven isoforms, B/B, E, F, G, D1, D2, and D3. This class of common proteins plays an essential role in the biogenesis of the snRNPs. The genes encoding human Sm G map to chromosomes 2. In addition, these proteins represent the major targets for the so-called anti-Sm auto-antibodies which are diagnostic for systemic lupus erythematosus (SLE). One class of these autoantibodies reacts specifically with native Sm E-F-G complexes. Recombinant human SNRPG protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03992
Size 50 µg
Host E.coli
Accession
Molecular Weight 10.6 kDa (96aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 50% glycerol, 0.1M NaCl
Other Names Small nuclear ribonucleoprotein polypeptide G, Sm-G, SMG
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap