SNRPE, 1-92aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SNRPE, also known as SME, aids in the cytoplasmic construction of the UsnRNPs by binding to a conserved Sm site on UsnRNA and forming a stable snRNP core complex. As a core protein to UsnRNP, the SNRPE associates with the entire U family of snRNAs including U1-U6. SNRPE also interacts with DDX20 and Small nuclear ribonucleoprotein polypeptide F. Recombinant human SNRPE protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03990
Size 10 µg
Host E.coli
Accession
Molecular Weight 12.9 kDa (112aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl, 5mM DTT, 1mM EDTA, 30% glycerol
Other Names Small nuclear ribonucleoprotein E, B-raf, Sm-E, SME
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap