SNRPA1, 1-255aa, Human, His tag E.coli

Categories: [Proteins / Peptides]
SNRPA1, also known as U2 small nuclear ribonucleoprotein A, is a component of the U2 snRNP that forms a complex with U2 snRNP B (U2B). Together, U2 snRNP A and U2 snRNP B form a complex that binds to the U2 snRNA hairpin IV. The configuration of this U2 snRNP A/U2 snRNP B dimer and the subtle variations of a few key residues regulate the snRNP-RNA-binding specificity. U2 snRNP A is a 255 amino acid protein, and two isoforms exist as a result of alternative splicing events. Recombinant human SNRPA1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03985
Size 10 µg
Host E.coli
Accession
Molecular Weight 30.5 kDa(275aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 30% glycerol, 0.2M NaCl,2mM DTT, 0.1mM PMSF
Other Names U2 small nuclear ribonucleoprotein A, Lea1, small nuclear ribonucleoprotein polypeptide A
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap