Home / Products / proteins / SNAPAP, 1-136aa, Human, His tagged, Recombinant, E.coli

SNAPAP, 1-136aa, Human, His tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
SNAPAP (SNAP associated protein) was enriched in neurons and exclusively located on synaptic vesicle membrane protein. SNAPAP is an important component of the neurotransmitter release process through its modulation of the sequential interactions between the SNAREs and synaptotagmin, which is a component of the SNARE complex that is required for synaptic vesicle docking and fusion. Recombinant human SNAPAP protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03979
Size 100 µg
Host E.coli
Accession
Molecular Weight 17 kDa (156aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 5 mM DTT, 2 mM EDTA, 0.2 M NaCl2, 40% glycerol
Other Names SNAPIN, SNAP25BP, SNAPAP, SNAP associated protein, SNAP associated protein SNARE associated protein snapin, Synaptosomal associated protein 25 binding protein
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap