Home / Products / proteins / SNAP25,1-206aa, Human, Recombinant, E.coli

SNAP25,1-206aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
The synaptosomal-associated protein (SNAP-25) is an essential component of the core complex that mediates presynaptic vesicle trafficking. Thus, SNAP-25 is directly involved in the release of neurotransmitters and this protein exists as two alternative isoforms, SNAP25A and SNAP25B which differ by 9 amino acids in central portion of these proteins. Recombinant SNAP25B protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03978
Size 100 µg
Host E.coli
Accession
Molecular Weight 23 kDa (206 aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMAMSLPGSRRTSAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSYKGSDSSPTPRRSMKYTLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEEECHRVEAQLALKEARKEIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGMAKEDGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSSGSAEDGADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSYWSRH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid in 25mM Tris pH 7.5, 1mM DTT, 2mM EDTA, 10% glycerol
Other Names FLJ23079, SNAP25, RIC-4, RIC4, SEC9, SNAP, SNAP-25, Synaptosomal-associated protein 25 isoform SNAP25B, Synaptosomal-associated protein 25 isoform SNAP25B SUP, Super protein, bA416N4.2, Bdr, dJ1068F16.2, HGNC:11132, MGC105414, MGC139754,
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap