SMNDC1, 1-238aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SMNDC1 (survival motor neuron domain containing 1) is an essential splicing factor required for spliceosome assembly that belongs to the SMN family. It contains one Tudor domain with significant similarity to SMN (Survival Motor Neuron) and is expressed in skeletal muscle, pancreas and heart, localizing to Cajal bodies and nuclear speckles. Mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. Recombinant human SMNDC1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03970
Size 50 µg
Host E.coli
Accession
Molecular Weight 28.9kDa (258aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 1mM DTT, 100mM NaCl
Other Names Survival of motor neuron-related-splicing factor 30, Survival of motor neuron-related-splicing factor 30
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap