Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP03964 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 22 kDa (199 aa), confirmed by MALDI-TOF. |
AP_Mol_Weight | |
Tag | |
Sequences | MASMTGGQQMGRGSMAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by Bradford assay) |
Formulation | Liquid in 20mM Tris pH 7.5 |
Other Names | SMAC3, DIABLO-S, FLJ10537, FLJ25049, Diablo isoform 1, SMAC/Diablo, Diablo isoform 1 0610041G12Rik, DBOH, Diablo homolog, DIABLO S, Diablo homolog (Drosophila), Mitochondrial Smac protein, Diablo homolog mitochondrial, SMAC 3, Smac protein. |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap