SMAC/Diablo, 56-239aa, Human, T7 tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Smac/Diablo is one of the proapoptotic proteins. Smac promotes caspase activation in the cytochrome c/Apaf-1/caspase-9 pathway by binding to inhibitor of apoptosis proteins (IAPs) and removing their inhibitory activity. Recombinant human Smac fused to T7-tag. at N-terminus was expressed in E.coli and purified by conventional chromatography techniques.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03964
Size 100 µg
Host E.coli
Accession
Molecular Weight 22 kDa (199 aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MASMTGGQQMGRGSMAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid in 20mM Tris pH 7.5
Other Names SMAC3, DIABLO-S, FLJ10537, FLJ25049, Diablo isoform 1, SMAC/Diablo, Diablo isoform 1 0610041G12Rik, DBOH, Diablo homolog, DIABLO S, Diablo homolog (Drosophila), Mitochondrial Smac protein, Diablo homolog mitochondrial, SMAC 3, Smac protein.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap