Home / Products / proteins / SLAMF6, 22-226aa, Human, His tag, E.coli

SLAMF6, 22-226aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SLAM family member 6, also known as SLAMF6, belongs to the SLAM family of immune cell receptors. SLAM is a novel receptor on T cells that, when engaged, potentiates T cell expansion in a CD28-independent manner. SLAMF6 is expressed on NK-, T-, and B cells. It exhibits homotypic interactions and can associate with adaptor molecules such as SAP to modulate immune cell functions. Recombinant human SLAMF6 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03959
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.5 kDa (228aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4 Urea, 10% glycerol
Other Names SLAM family member 6, CD352, KALI, KALIb, Ly108, NTB-A, NTBA, SF2000
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap