SLAMF6, 22-226aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
SLAMF6, also known as SLAM family member 6 isoform 1, belongs to the SLAM family of immune cell receptors. It is a novel receptor on T cells that, when engaged, potentiates T cell expansion in a CD28-independent manner. This protein is expressed on NK-, T-, and B cells. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. Recombinant human SLAMF6 protein, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03960
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 24.1kDa (214aa), 28-40KDa (SDS–PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names SLAMF family member 6 isoform 1, SLAMF6, CD352, KALI, KALIb, Ly108, NTB-A, NTBA, SF2000
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap