SLAM family member 7, 23-226aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
SLAMF7, also known as SLAM family member 7, is a single-pass type 1 membrane protein and a member of the CS2 family of cell surface receptors. Isoform 1 of this protein mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. It may play a role in lymphocyte adhesion. SLAMF7 can exert activating of inhibitory influences on cells of the immune system depending on cellular context and the availability of effector proteins. Recombinant human SLAMF7, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03956
Size 50 µg
Host Insect cell
Accession
Molecular Weight 23.4kDa (212aa) 28-40KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names SLAMF7, CD2 subset 1, CD2-like receptor-activating cytotoxic cells, CRACC, CS1, CD319.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap