Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP03954 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 18 kDa (160aa), confirmed by MALDI-TOF. |
AP_Mol_Weight | |
Tag | |
Sequences | MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 50mM NaCl, 10% glycerol |
Other Names | EMC19, MGC34403, OCP-II, OCP2, p19A, SKP1A, TCEB1L, S-phase kinase-associated protein 1 isoform a Cyclin A/CDK2 associated p19, Cyclin A/CDK2 associated protein p19. |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap