SKP1, 1- 160aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
S-phase kinase-associated protein 1, also known as SKP1, is an F-box protein which functions as a substrate recognition component of the SCF ubiquitin ligase complex. It binds to proteins containing an F-box motif, such as cyclin F, S-phase kinase-associated protein 2, and other regulatory proteins involved in ubiquitin dependent proteolysis. It is also involved in the control of beta-catenin levels and the activity of beta-catenin dependent TCF transcription factors. Recombinant human SKP1 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03954
Size 100 µg
Host E.coli
Accession
Molecular Weight 18 kDa (160aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag
Sequences MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 50mM NaCl, 10% glycerol
Other Names EMC19, MGC34403, OCP-II, OCP2, p19A, SKP1A, TCEB1L, S-phase kinase-associated protein 1 isoform a Cyclin A/CDK2 associated p19, Cyclin A/CDK2 associated protein p19.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap