Skp, 21-161aa, E.coli, His tag, E.coli

Categories: [Proteins / Peptides]
The Seventeen Kilodalton Protein (Skp) is a trimeric periplasmic chaperone that assists outer membrane proteins in their folding and insertion into membranes. This protein required for the efficient release of ompA from the inner membrane, the maintenance of its solubility in the periplasm, and, in association with lipopolysaccharide (LPS), for the efficient folding and insertion of ompA into the outer membrane. Recombinant E.coli Skp, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03953
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.9 kDa (162aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMADKIAIVNMGSLFQQVAQKTGVSNTLENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol
Other Names Chaperone protein skp, Chaperone protein skp, periplasmic chaperone, ompH, DNA binding 17 kDa protein, ECK0177, Histone like protein HLP 1, hlpA, JW0173, Seventeen kilodalton protein
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap