SIRT3, 118-399aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NAD-dependent deacetylase sirtuin-3, mitochondrial, also known as SIRT3, belongs to the sirtuin family of proteins. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have a range of molecular functions and have emerged as important proteins in aging, stress resistance and metabolic regulation. SIRT3 exhibits NAD+-dependent deacetylase activity in the mitochondria. Over-expression of SIRT3 results in increased levels of the mitochondrial uncoupling protein 1. SIRT3 protein levels are also elevated in certain breast cancers. Recombinant human SIRT3 protein, fused to Histag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03945
Size 50 µg
Host E.coli
Accession
Molecular Weight 33.5kDa (303aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 0.1M NaCl
Other Names NAD-dependent deacetylase sirtuin-3, mitochondrial, SIR2L3, Sirtuin3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap