SIAH1, 90-282aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
E3 ubiquitin-protein ligase SIAH1, also known as SIAH1, is a member of the seven in absentia homolog (SIAH) family. SIAH1 is a tumor suppressor protein that is expressed in intestinal epithelium and activated during apoptosis. SIAH1 contains an N-terminal RING-finger domain, which is required for proteolysis, and a cystein-rich C-terminal domain, which regulates oligomerization and SIAH binding to target proteins. SIAH1 is known to cause indirect degradation of beta-catenin through formation of a complex with Siah-interacting protein (SIP), Skp1 and Ebi. Recombinant human SIAH1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03936
Size 50 µg
Host E.coli
Accession
Molecular Weight 24.1 kDa (216aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Purity > 95% by HPLC
Concentration 0.25 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 40% glycerol,1mM DTT
Other Names E3 ubiquitin-protein ligase SIAH1, SIAH1A.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap