SHH, 25-198 aa, Mouse, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
SHH is one of three proteins in the mammalian signaling pathway family called hedgehog, the others being desert hedgehog (DHH) and Indian hedgehog (IHH). This protien is the best studied ligand of the hedgehog signaling pathway. It plays a key role in regulating vertebrate organogenesis. SHH contain amino-terminal signal peptides and apparently function as secreted proteins involved in the mediation of various cell-cell interactions. Recombinant mouse SHH protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03934
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.8 kDa (183aa)
AP_Mol_Weight
Tag
Sequences MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGLEHHHHHH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol 1mM DTT.
Other Names Sonic hedgehog protein, Dsh, Hhg1, Hx, Hx13.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap