SHH, 24-197aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SHH, also known as Sonic hedgehog protein, is one of three proteins in the mammalian signaling pathway family called hedgehog. It plays a key role in regulating vertebrate organogenesis, such as in the growth of digits on limbs and organization of the brain. It controls cell division of adult stem cells and has been implicated in development of some cancers. Recombinant human SHH protein, fused to His-tag at C-terminus was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03933
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.7 kDa (183aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGLEHHHHHH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.1M NaCl
Other Names Sonic hedgehog protein, HHG1, HLP3, HPE3, SMMCI, TPT, TPTPS
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap