Home / Products / proteins / SH3BGRL3, 1-93aa, Human, His tag, E.coli

SH3BGRL3, 1-93aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SH3 domain-binding glutamic acid-rich-like protein 3, also known as SH3BGRL3, is located to chromosome 1p34.3-35 encodes for a small protein of 93 amino acids. SH3BGRL3 is the new member of thioredoxin (TRX) super family, whose posttranslational modified form was identified as tumor necrosis factor alpha (TNF-alpha) inhibitory protein. It may function as a regulator in all-trans retinoic acid-induced pathway. Recombinant human SH3BGRL3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03925
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.8 kDa (116aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA
Purity > 95% by HPLC
Concentration 1 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol,1mM DTT
Other Names SH3 domain-binding glutamic acid-rich-like protein 3 , SH3BP-1, TIP-B1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap