SH3BGRL2, 1-107aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SH3 domain-binding glutamic acid-rich-like protein 2, also known as SH3BGRL2, is a member of the human SH3BGR family. SH3BGRL2 gene located to chromosome 6q13-15 and its messenger RNA has a large 3' untranslated region containing several AUUUA repeats. SH3BGRL2 codes for a protein of 107 amino acids, which, like SH3BGRL and SH3BGRL3 proteins, is highly homologous to the N-terminal region of the SH3BGR protein and appears to be related to Glutaredoxins and to PKC-interacting cousin of thioredoxin homology domain. Recombinant human SH3BGRL2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03924
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.7 kDa (130aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMVIRVFIASSSGFVAIKKKQQDVVRFLEANKIEFEEVDITMSEEQRQWMYKNVPPEKKPTQGNPLPPQIFNGDRYCGDYDSFFESKESNTVFSFLGLKPRLASKAEP
Purity > 95% by HPLC
Concentration 0.5 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol,1mM DTT
Other Names SH3 domain-binding glutamic acid-rich-like protein 2, FASH3, Fovea-associated SH3 domain-binding protein, SH3 domain-binding glutamic acid-rich-like protein 2, SH3 domain binding glutamic acid rich like protein 2.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap