SH2D1A, 1-128aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SH2D1A is an inhibitor of the signaling lymphocyte activation molecule (SLAM) self-association. This protein is expressed at a high level in thymus and lung, with a lower level of expression in spleen and liver. Defects in SH2D1A are a cause of X-linked lymphoproliferative disease (XLPD) also known as Duncan disease. XLPD is characterized by a rare congenital immunodeficiency following Epstein-Barr virus (EBV) infection. Recombinant human SH2D1A protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03922
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.3 kDa(148aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl Buffer (pH 7.5) containing 1 mM DTT, 10% Glycerol
Other Names SH2 domain-containing protein 1A NCBI Accession, DSHP, EBVS, IMD5, LYP, MTCP1, SAP, XLP, XLPD
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap