SFRP4, 19-346aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
SFRP4, also known as secreted frizzled-related protein4, is a family of vertebrate proteins which contain homology to the ligand-binding domain of the Frizzled family of transmembrane receptors. It is expressed in brain, kidney, lung, ovary, prostate, mammary gland and endometrium. This protein act as soluble modulators of Wnt signaling, counteracting Wnt-induced effects at high concentrations and promoting them at lower concentrations. It is able to bind Wnt proteins and Frizzled receptors in the extracellular compartment. Recombinant human SFRP4, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03914
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 38.9kDa (337aa), 40-57KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRVHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Secreted frizzled-related protein 4, SFRP4, FRP-4, FRPHE, PYL, sFRP-4
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap