SF20/IL25, 33-173aa, Human, His-Tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
SF20/25, originally identified as a product of bone marrow-derived stromal cells, was previously thought to support proliferation of lymphoid cells and was designated as interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. Recombinant human SF20/IL25 protein, fused to His-tag at Nterminus, was expressed in E.coli and purified by using conventional chromatography techniques, after refolding of the isolated inclusion bodies in a renaturation buffer.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03911
Size 100 µg
Host E.coli
Accession
Molecular Weight 18 kDa (162 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 20% glycerol
Other Names Stromal cell-derived growth factor, C19orf10, IL25, UPF0556, IL27, IL27w
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap