Serum Amyloid A, 19-122 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Serum amyloid A1(SAA1) protein is made primarily in the liver and circulates in low levels in the blood. This protein appears to play a role in the immune system. Levels of this protein increase in the blood and other tissues under conditions of inflammation. SAA1 may help repair damaged tissues, acts as an antibacterial agent, and signal the migration of germ-fighting cells to sites of infection. Elevated levels of SAA over time predispose secondary amyloidosis, extracellular accumulation of amyloid fibrils, derived from a circulating precursor, in various tissues and organs. The most common form of amyloidosis occurs secondary to chronic inflammatory disease, particularly rheumatoid arthritis. Recombinant Serum amyloid A protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03908
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.9 kDa (125aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris buffer(pH 8.0) containing 10% glycerol.
Other Names SAA1, PIG4, TP53I4
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap