Home / Products / proteins / SDHAF1, 1-115aa Human, His tag, E.coli

SDHAF1, 1-115aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
Succinate dehydrogenase assembly factor 1, also known as SDHAF1, plays an essential role in succinate dehydrogenase complex (SDH) assembly, a complex involved in complex II of the mitochondrial electron transport chain. Probably this protein acts by participating in mitochondrial biosynthesis of iron-sulfur centers for complex II. Recombinant human SDHAF1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03873
Size 20 µg
Host E.coli
Accession
Molecular Weight 15.2 kDa (138aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSRHSRLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLRSGHATAMGAFVRPRAPTGEPGGVGSQPDDGDSPRNPHDSTGAPETRPDGR
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate buffered saline (pH7.4), 30% glycerol, 2mM DTT, 0.1mM PMSF
Other Names Succinate dehydrogenase assembly factor 1, LYRM8
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap