SDF-1, 22-93aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
SDF-1 is small cytokine belonging to the chemokine family that is officially designated Chemokine (CX-C motif) ligand 12 (CXCL12). SDF-1 is strongly chemotactic for lymphocytes and works by its receptor CXCR4. The SDF-1+CXCR4 complex plays a significant role in the creation of metastases of neoplasms and as a response to cytostatic treatment. Identification of this complex may be a useful prognostic factor in the therapy of many types of carcinoma. Recombinant human SDF-1, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03871
Size 50 µg
Host E.coli
Accession
Molecular Weight 10.8 kDa (93aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names Stromal cell-derived factor 1, CXCL12, PBSF, hIRH
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap