SCN3B, 23-159aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
SCN3B, also known as sodium channel subunit beta-3, is an additional auxiliary subunit of the voltage-sensitive sodium channel that modulates channel gating with distinct kinetics. It was detected in brain, heart, kidney, lung, pancreas and skeletal muscle. It is expressed in adult mammalian skeletal muscle and can functionally couple to the skeletal muscle alpha subunit, SkM1. It associates with neurofascin through their extracellular immunoglobulin-like domain. Recombinant human SCN3B, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03863
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 16.8kDa (146aa), 18-28kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences ADPFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEHHHHHH
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Sodium channel subunit beta-3, SCN3B, ATFB16, BRGDA7, HSA243396, SCNB3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap