SCGN, 1-276aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SCGN, also known as secretagogin, is a cytoplasmic protein that contains six EF-hand domains and is related to the calicium-binding proteins Calretinin and Calbindin D28K. This protein is thought to be involved in cell proliferation and KCl (potassium chloride)-mediated calcium flux events. Through its interaction with KCl and its subsequent ability to modulate calcium storage pools within the cell, SCGN may function to negatively control growth and differentiation rates and, thus, indirectly inhibit cell replication. Recombinant SCGN protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03861
Size 50 µg
Host E.coli
Accession
Molecular Weight 34.2 kDa (296aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol 1mM DTT, 0.1M NaCl.
Other Names Secretagogin, CALBL, DJ501N12.8, SECRET, SEGN, setagin
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap