Home / Products / proteins / SCG5, 27-212aa, Human, His tag, E.coli

SCG5, 27-212aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
SCG5, also known as Neuroendocrine protein 7B2, is widely distributed in neuroendocrine tissues. It functions as a chaperone protein for the proprotein convertase PC2 and is required for the production of an active PC2 enzyme. Recombinant human SCG5 protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03860
Size 50 µg
Host E.coli
Accession
Molecular Weight 22.0 kDa (195aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLSDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPELEHHHHHH
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl,1mM DTT, 01mM PMSF
Other Names Neuroendocrine protein 7B2, 7B2, SgV, P7B2, SGNE1, Secretogranin-5, Secretory granule endocrine protein I
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap