SAP18, 20- 172 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
SAP18, also known as Sin3A-associated protein, is component of the histone deacetylase complex that plays an important role in the regulation of eukaryotic gene expression. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. It also has been shown to play a key role in gene-specific recruitment of the HDAC complex by a number of transcription factors including Gli, GAGA, and Bicoid.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03849
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.7 kDa (173 aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 0.1M NaCl, 30% glycerol, 1mM DTT
Other Names Sin3A-associated protein, 18kDa, 2HOR0202, SAP18P
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap