Home / Products / proteins / SAE1, 1-346aa, Human, His-T7 tag, E.coli

SAE1, 1-346aa, Human, His-T7 tag, E.coli

Categories: [Proteins / Peptides]
SAE1, also known as AOS1, belongs to the ubiquitin-activating E1 family of proteins and plays an important role in the first step of the UBL1 conjugation pathway. Proteins conjugated to Ub are marked for progressive degradation by the 26S Proteasome. SAE1, which is a dimeric enzyme, functions as a UBLI E1 ligase mediating the ATP-dependent activation of UBL1.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03846
Size 50 µg
Host E.coli
Accession
Molecular Weight 42.2 kDa (378aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MHHHHHHMASMTGGQQMGRDLYDDDDKDRWGSMVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT, 10% glycerol
Other Names SUMO1 activating enzyme subunit 1, AOS1, HSPC140, SUA1, UBLE1A
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap