Home / Products / proteins / S100A9, 1-114aa, Human, His tag, E.coli

S100A9, 1-114aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
S100-A9, also known as Calgranulin B, belongs to the S100 family containing EF-hand type Ca2+- binding proteins. It is involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation, and associated with the disease cystic fibrosis. S100A9 has been implicated in the abnormal differentiation of myeloid cells in the stroma of cancer.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03838
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.3 kDa (122aa)
AP_Mol_Weight
Tag N-6His
Sequences MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTPLEHHHHHH
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.1M NaCl
Other Names Protein S100-A9, Calgranulin B, 60B8AG, CAGB, CFAG, CGLB, L1AG, LIAG, MAC387, MIF, MRP14, NIF, P14.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap