S100A8-Myc, 1-93aa, Human, His tag, Myc tag, E.coli

Categories: [Proteins / Peptides]
S100A8, also known as S100A8 isoform d. S100A8 is a member of the S100 family, EF-hand superfamily of Calcium binding proteins. S100A8 protein is localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. It functions both intracellularly and extracellularly, where it binds to RAGE and CD36. Altered expression of this protein is associated with the disease cystic fibrosis. Recombinant human S100A8, fused to His-tag at N-terminus, fused to Myc-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03836
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.5kDa (127aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEEQKLISEEDL
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl (pH 8.0) containing 10% glycerol, 0.1M NaCl
Other Names 60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap