S100A8, 1- 93 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
S100 calcium binding protein A8, also known as MRP8, is a member of the S100 family, EF-hand superfamily of Calcium binding proteins. S100A8 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. It functions both intracellularly and extracellularly, where it binds to RAGE and CD36. Altered expression of this protein is associated with the disease cystic fibrosis
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03834
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.8 Da (93aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol
Other Names S100 calcium binding protein A8, Calgranulin-A, MRP-8, CFAG, CAGA.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap