S100A8, 1-89aa, Mouse,His tag, E.coli

Categories: [Proteins / Peptides]
S100A8, also known MRP8, is a member of the S100 family, EF-hand superfamily of calcium binding proteins. This protein is localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. It functions both intracellularly and extracellularly, where it binds to RAGE and CD36. Altered expression of this protein is associated with the disease cystic fibrosis.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03835
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.4 kDa (109aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 30% glycerol 0.1M NaCl,1mM DTT
Other Names Protein S100-A8, 60B8Ag, AI323541, B8Ag, Caga, CFAg, CP-10, MRP8, p8
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap