S100A7, 1-101aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
S100A7, also known as Psoriasin, belongs to the S-100 family of calcium binding proteins and is secreted via a non-classical secretory pathway into the cytoplasm. It is thought to function in the regulation of many cellular processes, including the cell cycle, cell progression and cellular differentiation. It contains two EF-hand domains and is highly upregulated in psoriatic epidermis, as well as in bladder squamous cell carcinoma and breast cancer tissue, suggesting a possible role in carcinogenesis.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03833
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.6 kDa (121aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 30% glycerol 0.1M NaCl, 1mM DTT
Other Names S100 calcium binding protein A7, S100A7c.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap