Home / Products / proteins / S100A6, 1-89aa, Mouse, His tag, E.coli

S100A6, 1-89aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
S100 calcium binding protein A6 (S100A6) belongs to the S100 family. S100 family is containing 2 EF-hand calcium-binding motifs. S100 proteins regulate a number of cellular processes such as cell cycle progressions and differentiation. S100A6 plays a role in the reorganization of the actin cytoskeleton and in cell mobility. This is a specific target of S-100B protein in vivo.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03831
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.2kDa (109aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 30% glycerol, 100mM NaCl
Other Names S100 calcium binding protein A6 (calcyclin), 2A9, 5B10, Cacy, CALCYCLIN, PRA
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap