Home / Products / proteins / S100A5, 1-93aa, Mouse, His tag, E.coli

S100A5, 1-93aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
S100 calcium binding protein A5, also known as S100A5, is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A5 has a Ca2+ affinity 20- to 100-fold higher than the other S100 proteins studied under identical conditions.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03830
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.4kDa (117aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKTELSLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDNK
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer, pH8.0, 40% glycerol, 3mM DTT, 200mM NaCl
Other Names S100 calcium binding protein A5, S100D9.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap