S100A4, 1-101aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
S100A4 belongs to the S100 super-family of proteins containing 2 EF-hand calcium binding domains. This protein is ubiquitously overexpressed and is localized in the cytoplasm and/or nucleus. S100A4 may play a role in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of the S100A4 have been implicated in tumor metastasis.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03828
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.9 kDa (121aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 20% glycerol, 2mM DTT, 0.1M NaCl.
Other Names S100 calcium binding protein A4., 18A2, 42a, Capl, FSp1, metastasin, Mts1, PeL98, pk9a.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap