Home / Products / proteins / S100A3, 1-101aa Mouse, His tag, E.coli

S100A3, 1-101aa Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
S100A3, also known as Protein S-100E and S100 calcium-binding protein A3, belongs to the S-100 family of proteins containing 2 EF-hand calcium-binding motifs. The S100 proteins act as multifactional signaling factors that are involved in the regulation of diverse cellular processes such as cell cycle progression and differentiation. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03825
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.3kDa (125aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTWTPSEFRECDYNKFMSVLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ
Purity > 95% by HPLC
Concentration 1mg/ml
Formulation Liquid. In 20 mM Tris-HCl buffer, pH8.0, 10% glycerol, 2mM DTT, 150mM NaCl
Other Names S100 calcium binding protein A3, S100E.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap