Home / Products / proteins / S100A2, 1-97aa, Human, His tag, E.coli

S100A2, 1-97aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
S100A2 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100A2 may act as a modulator against excess calcium accumulation in normal human mammary epithelial cells and also play a role in suppressing tumor cell growth. This protein may have a tumor suppressor function.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03824
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.1 kDa (117aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 5mM DTT, 30% glycerol, 0.2M NaCl
Other Names S100 calcium binding protein A2, CAN19, S100L
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap