Home / Products / proteins / S100A15, 1-108aa, Mouse, His tag, E.coli

S100A15, 1-108aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
Mouse S100A15 is a protein of 104 amino acids with a predicted molecular weight of 12,870 Da and two EF-hand calcium binding sites. It is expressed in both skin and keratinocytes. S100A15 expression is upregulated in cultured keratinocytes induced to differentiate by calcium or phorbol esters.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03822
Size 50 µg
Host E.coli
Accession
Molecular Weight 15 kDa (132aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 20% glycerol
Other Names S100 calcium binding protein A15, AY465109, Gm1020, S100a7a, S100a15a, S100a17l1, S100A7f, S100A7L1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap