RWDD1, 1-243aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RWDD1, also known as CGI-24 or PTD013, belongs to the RWDD1/GIR2 family. This protein protects DRG2 (developmentally regulated GTP binding protein 2), from proteolytic degradation. RWDD1 is a novel RWD domain containing protein. RWD domain refers to three signature motifs in proteins: RING finger, WD-repeats, and yeast DEAD (DEXD)-like motif. The function of this domain is not clear enough. Present evidence suggests that RWD domain might be necessary for protein-protein interaction. Recombinant human RWDD1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03813
Size 50 µg
Host E.coli
Accession
Molecular Weight 30.3kDa (266aa), confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDEDDPDYNPADPESDSAD
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl,10% glycerol, 2mM DTT
Other Names RWD domain-containing protein 1, CGI-24, PTD013
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap