Home / Products / proteins / RPLP2, 1-115aa, Human, His tag, E.coli

RPLP2, 1-115aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
60S acidic ribosomal protein P2, also known as RPLP2, belongs to the L12P family of ribosomal proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. It is a functional equivalent of the E. coli L7/L12 ribosomal protein. RPLP2 is located in the cytoplasm. It plays an important role in the elongation step of protein synthesis.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03781
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.2 kDa (139aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 0.1M NaCl
Other Names 60S acidic ribosomal protein P2, LP2, P2, RPP2.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap