RPL18A, 1-176aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL18A is a ribosomal protein that is a component of the 60S subunit. This protein belongs to the L18AE family of ribosomal proteins. It is located in the cytoplasm. RPL18A is co-transcribed with the U68 snoRNA, which is located in its third intron. Recombinant human RPL18A protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03769
Size 100 µg
Host E.coli
Accession
Molecular Weight 23.2 kDa (199aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names 60S ribosomal protein L18a , L18A
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap