Home / Products / proteins / rnhA, 1-155aa, E.coli, His tag, E.coli

rnhA, 1-155aa, E.coli, His tag, E.coli

Categories: [Proteins / Peptides]
rnhA is an endonuclease that specifically degrades the RNA of RNA-DNA hybrids. Localized to the nucleus, this protein mediates the removal of Okazaki fragment RNA primers that are present on the lagging strand during DNA replication. rnhA catalyzes the endonucleolytic cleavage of RNA to a 5'-phosphomonoester and is able to bind magnesium or manganese as cofactors.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03757
Size 100ug
Host E.coli
Accession
Molecular Weight 20 kDa (178aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 2mM DTT.
Other Names Ribonuclease HI, degrades RNA of DNA-RNA hybrids, cer, dasF, ECK0214, herA, JW0204, rnh, sdrA, sin.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap