Home / Products / proteins / RND1, 1-200aa, Human,His tag, E.coli

RND1, 1-200aa, Human,His tag, E.coli

Categories: [Proteins / Peptides]
RND1, also known as Rho 6, is Rho-related GTPases form a distinct branch of the Rho family, since they differ from other Rho proteins in size, charge, and biochemical properties. It appears to be constitutively in the activated GTP-bound form and acts as negative regulators of actin assembly and of cell adhesion. It contributes to regulating the organization of the actin cytoskeleton in response to extracellular growth factors.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03749
Size 100 µg
Host E.coli
Accession
Molecular Weight 24.5 kDa (220aa), confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPV
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 30% glycerol 0.1M NaCl,1mM DTT
Other Names Rho-related GTP-binding protein Rho6, ARHS, FLJ42294, RHO6, RHO
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap