RNASE7, 29-156aa, Human His tag, E.coli

Categories: [Proteins / Peptides]
RNASE7 is one of the final RNase A superfamily ribonucleases. It was isolated from skin-derived stratum corneum. This protein exhibited potent ribonuclease activity and thus may contribute to the well known ribonuclease activity of human skin. It revealed broad spectrum antimicrobial activity against many pathogenic microorganisms and remarkably potent activity against a vancomycin-resistant Enterococcus faecium. Recombinant human RNASE7 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03747
Size 50 µg
Host E.coli
Accession
Molecular Weight 16.9 kDa(151aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSKPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 1mM DTT
Other Names Ribonuclease, RNase A family, 7, MGC133220, Ribonuclease RNase A family 7, RNase 7, Ribonuclease 7, Skin-derived antimicrobial protein 2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap