RLN2, 25-185aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
RLN2, as known as prorelaxin H2 isoform 1, belongs to the insulin gene superfamily. This family is produced by the ovary, and targets the mammalian reproductive system to ripen the cervix, elongate the pubic symphysis and inhibit uterine contraction. It may have additional roles in enhancing sperm motility, regulating blood pressure, controlling heart rate and releasing oxytocin and vasopressin. It is 18 kDa in size and 185 aa in length. It contains a 24 aa signal sequence, a 3.3 kDa, 29 aa B domain, a 106 aa C (or connecting) domain, and a C-terminal, 2.7 kDa, 24 aa A domain. Recombinant human RLN2, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03744
Size 20 µg
Host Baculovirus
Accession
Molecular Weight 19.3kDa (170aa) 18-28kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPDSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFCHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by BCA assay)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Prorelaxin H2 isoform 1, RLN2, bA12D24.1.1, bA12D24.1.2, H2, H2-RLX, RLXH2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap