Home / Products / proteins / RHOV, 1-236aa, Human, His tag, E.coli

RHOV, 1-236aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Rho-related GTP-binding protein RhoV, also known as RHOV, is a member of the Rho family and small GTPase superfamily. RHOV is a 236 amino acid protein that controls the actin cytoskeleton through activation of the JNK pathway. RHOV functions as a lipid anchor at the cytoplasmic side of the cell membrane and is expressed in placenta, pancreas and fetal brain. Recombinant human RHOV protein, fused to His-tag at Nterminus, was expressed in E.coli.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03739
Size 100 µg
Host E.coli
Accession
Molecular Weight 28.6 kDa (259aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMPPRELSEAEPPPLRAPTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKARLEKKLNAKGVRTLSRCRWKKFFCFV
Purity > 95% by HPLC
Concentration 1 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2M Urea,20% glycerol, 0.1M NaCl, 1mM DTT
Other Names Rho-related GTP-binding protein RhoV, ARHV, CHP, WRCH2.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap