RHOQ, 1-202aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RHOQ, also known as rho-related GTP-binding protein RhoQ, is a small signaling G protein (more specifically a GTPase), and is a member of the Rac subfamily of the family Rho family of GTPases. It involved in epithelial cell polarization processes. It may play a role in CFTR trafficking to the plasma membrane. It causes the formation of thin, actin-rich surface projections called filopodia. Recombinant human RhoQ protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03738
Size 50 µg
Host E.coli
Accession
Molecular Weight 24.7kDa (225aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCC
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 1mM DTT
Other Names Rho-related GTP-binding protein RhoQ precursor , ARHQ, RASL7A, TC10, TC10A
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap