RhoG, 1-188aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
RhoG(Ras homology Growth-related) is a member of the Rac subfamily of the Rho family of small G proteins. RhoG is a small monomeric GTP-binding protein (G protein), and is an important component of many intracellular signalling pathways. This protien are required for the formation of membrane ruffles during macropinocytosis. It plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03737
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.2kDa (225aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSC
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer, pH8.0, 40% glycerol, 5mM DTT, 200mM NaCl
Other Names Rho-related GTP-binding protein RhoG, ARHG
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap